PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012352-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 513aa    MW: 56582.6 Da    PI: 8.4356
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012352-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34e-1958104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd ll dav+++ g++Wk+Ia+ ++ gRt+ qc +rwqk+l
  AHYPO_012352-RA  58 KGGWTEEEDNLLTDAVRKFNGKSWKLIAENLP-GRTDVQCLHRWQKVL 104
                      688*****************************.************986 PP

2Myb_DNA-binding65.59.7e-21110156148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ +++ v+q+G ++W+ Ia++++ gR +kqc++rw+++l
  AHYPO_012352-RA 110 KGPWTKEEDDCIIEMVHQHGCRSWSVIAKHLP-GRIGKQCRERWYNHL 156
                      79******************************.*************97 PP

3Myb_DNA-binding49.21.2e-15162204145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r++WT+eE+  l  +++ +G++ W+ Ia  ++ gRt++ +k++w+
  AHYPO_012352-RA 162 RDAWTEEEESVLSYYHQIYGNR-WAEIATFLP-GRTDNAIKNHWN 204
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575135No hitNo description
PROSITE profilePS5129417.59153104IPR017930Myb domain
SMARTSM007171.8E-1657106IPR001005SANT/Myb domain
PfamPF002496.8E-1758104IPR001005SANT/Myb domain
SuperFamilySSF466897.59E-1659114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2360117IPR009057Homeodomain-like
CDDcd001671.18E-1461104No hitNo description
PROSITE profilePS5129429.706105160IPR017930Myb domain
SuperFamilySSF466897.49E-31107203IPR009057Homeodomain-like
SMARTSM007171.2E-17109158IPR001005SANT/Myb domain
PfamPF002496.0E-20110156IPR001005SANT/Myb domain
CDDcd001678.39E-17112156No hitNo description
Gene3DG3DSA:1.10.10.605.0E-27118163IPR009057Homeodomain-like
SMARTSM007174.6E-15161209IPR001005SANT/Myb domain
PROSITE profilePS5129418.781161211IPR017930Myb domain
PfamPF002496.3E-13162204IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-20164211IPR009057Homeodomain-like
CDDcd001671.24E-11164204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MMKMSGVNIV YDELNLGSPD GVSIPSNSSL SSSSCDTSTP RSTPLQGRTR GPTRRSSKGG  60
WTEEEDNLLT DAVRKFNGKS WKLIAENLPG RTDVQCLHRW QKVLNPELVK GPWTKEEDDC  120
IIEMVHQHGC RSWSVIAKHL PGRIGKQCRE RWYNHLDPAI KRDAWTEEEE SVLSYYHQIY  180
GNRWAEIATF LPGRTDNAIK NHWNCSLKNK LAASSLKGSA GSIHKTTNFK KASCEIEKLD  240
LPRVDVAALC HEDRCSTLPN GSQTCSTVLS LGTSPSEADL SETKLNPSRM CNEKSDSYGG  300
ANLQLPGTAK ITSLNFSTTN YKAQPPSMLK LDSPKRPRND SINADKLFKN LDKSFLSLGM  360
SGMSECETPG KKSKVNCIST PSEDTKYTNL CYESPGLRIV QTGHELDYAE NNNAQTDSPL  420
CFTTPTRQVT PATGSSSPES ILRNCAKSFT TPSIIRRRSS GKSTRSVEKG MKSRDVSNVI  480
SPVYKSVERC LEHSFAMEAD LGEPKCGTSI HN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-66582116159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-66582116159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676521.10.0PREDICTED: uncharacterized protein LOC104892321
RefseqXP_010676520.10.0PREDICTED: uncharacterized protein LOC104892321
TrEMBLA0A0J8CJ850.0A0A0J8CJ85_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.26e-81myb domain protein 3r-5